Functional test

>Unknow sequence for GBIO Web Services test ( C Blanchet, 14 jan 2009)
MKKITIYDLAELSGVSASAVSAILNGNWKKRRISAKLAEKVTRIAEEQGYAINRQASMLR
SKKSHVIGMIIPKYDNRYFGSIAERFEEMARERGLLPIITCTRRRPELEIEAVKAMLSWQ
VDWVVATGATNPDKISALCQQAGVPTVNLDLPGSLSPSVISDNYGGAKALTHKILANSAR
RRGELAPLTFIGGRRATITPASVYAASTMRIASWGLACRRRIFWLPAIRKATLRTACRSG
LAARRRCCRGYLLTRRYPWKGLCAGCRRWV

MPSA code : physchem
primname Unknown ; primlen 270
>Unknow sequence for GBIO Web Services test ( C Blanchet, 14 jan 2009)
compwin 7 ; methnb 7 ; meths 1 2 3 4 5 6 7
Hydrophilicity (Hoop & Woods, 1981)
Hydropathy (Kyte & Doolittle, 1982)
Flexibility (Karplus & Schulz, 1985)
Antigenicity (Parker et al., 1986)
Accessibility (Janin, 1979)
Membrane buried-helix (Argos, 1986)
Antigenicity (Welling, 1985)
M  0.000e+00  0.000e+00  0.000e+00  0.000e+00  0.000e+00  0.000e+00  0.000e+00
K  0.000e+00  0.000e+00  0.000e+00  0.000e+00  0.000e+00  0.000e+00  0.000e+00
K  0.000e+00  0.000e+00  0.000e+00  0.000e+00  0.000e+00  0.000e+00  0.000e+00
I  3.429e-01 -1.029e+00  9.926e-01  0.000e+00  6.243e+00  3.471e-01  5.714e-03
T  9.571e-01 -1.800e+00  9.660e-01  0.000e+00  6.557e+00  1.600e-01  1.536e-01
I  2.714e-01 -7.000e-01  9.419e-01  0.000e+00  3.671e+00  3.571e-01  2.313e-01
Y -2.286e-01  1.143e-01  9.331e-01  0.000e+00  8.143e-01  5.386e-01  2.183e-01
D  4.571e-01 -1.029e+00  9.340e-01  0.000e+00  1.229e+00  3.686e-01  6.253e-01
L  2.571e-01 -3.857e-01  9.414e-01  0.000e+00  1.086e+00  4.243e-01  7.389e-01
A  5.571e-01 -1.143e+00  9.526e-01  0.000e+00  1.214e+00  3.571e-01  1.152e+00
E  8.857e-01 -1.014e+00  9.664e-01  0.000e+00  1.014e+00  3.943e-01  1.124e+00
L  2.429e-01  8.571e-02  9.831e-01  0.000e+00  6.714e-01  5.743e-01  1.029e+00
S  5.429e-01 -5.714e-01  9.949e-01  4.479e-01  7.857e-01  5.029e-01  9.186e-01
G  5.429e-01 -5.714e-01  1.001e+00  4.479e-01  7.857e-01  5.029e-01  9.186e-01
V  1.571e-01 -1.857e-01  9.932e-01  0.000e+00  5.000e-01  6.057e-01  9.250e-01
S  3.429e-01 -4.714e-01  9.803e-01  4.549e+01  5.286e-01  5.900e-01  8.343e-01
A  8.571e-02  2.429e-01  9.704e-01  0.000e+00  4.000e-01  6.471e-01  8.361e-01
S  1.286e-01  1.857e-01  9.536e-01  3.151e+00  4.857e-01  6.300e-01  8.587e-01
A  2.714e-01 -1.571e-01  9.457e-01  2.928e+01  5.286e-01  6.286e-01  8.770e-01
V -2.857e-02  6.000e-01  9.354e-01  0.000e+00  4.000e-01  6.957e-01  4.636e-01
S -2.143e-01  8.857e-01  9.269e-01  0.000e+00  3.714e-01  7.114e-01  5.543e-01
A -2.286e-01  5.000e-01  9.311e-01  0.000e+00  5.286e-01  6.200e-01  4.480e-01
I -1.571e-01  1.857e-01  9.460e-01  0.000e+00  5.286e-01  5.814e-01  4.053e-01
L  8.571e-02 -9.143e-01  9.739e-01  0.000e+00  8.143e-01  4.329e-01  2.971e-01
N -4.429e-01 -9.286e-01  9.975e-01  0.000e+00  7.286e-01  4.371e-01  2.846e-01
G  5.714e-02 -1.743e+00  1.021e+00  0.000e+00  3.586e+00  2.557e-01  2.976e-01
N  7.429e-01 -2.943e+00  1.028e+00  2.257e+01  6.486e+00  6.286e-02  7.441e-01
W  1.429e+00 -4.129e+00  1.030e+00  6.578e+01  7.714e+00 -1.257e-01  6.453e-01
K  1.829e+00 -4.271e+00  1.040e+00  7.177e+01  8.671e+00 -1.514e-01  7.636e-01
K  1.571e+00 -3.571e+00  1.040e+00  4.738e+01  8.629e+00 -1.014e-01  3.727e-01
R  1.586e+00 -3.186e+00  1.033e+00  4.011e+01  8.471e+00 -1.000e-02  4.790e-01
R  2.000e+00 -2.800e+00  1.024e+00  3.797e+01  8.471e+00  4.143e-02  5.117e-01
I  2.000e+00 -2.800e+00  1.011e+00  3.797e+01  8.471e+00  4.143e-02  5.117e-01
S  1.314e+00 -1.700e+00  9.994e-01  0.000e+00  5.586e+00  2.386e-01  5.894e-01
A  8.143e-01 -8.000e-01  1.000e+00  0.000e+00  4.386e+00  4.114e-01  5.976e-01
K  8.143e-01 -6.571e-01  1.001e+00  0.000e+00  3.557e+00  4.257e-01  5.791e-01
L  1.500e+00 -1.857e+00  1.001e+00  2.297e+01  6.457e+00  2.329e-01  1.026e+00
A  1.243e+00 -1.143e+00  1.005e+00  0.000e+00  6.329e+00  2.900e-01  1.028e+00
E  1.257e+00 -1.500e+00  1.014e+00  0.000e+00  6.443e+00  2.500e-01  1.005e+00
K  1.257e+00 -1.586e+00  1.023e+00  0.000e+00  4.786e+00  2.586e-01  9.836e-01
V  1.257e+00 -1.486e+00  1.018e+00  0.000e+00  4.771e+00  2.543e-01  4.593e-01
T  1.257e+00 -1.486e+00  1.010e+00  0.000e+00  4.771e+00  2.543e-01  4.593e-01
R  1.257e+00 -1.486e+00  9.947e-01  0.000e+00  4.771e+00  2.543e-01  4.593e-01
I  1.257e+00 -1.429e+00  9.837e-01  0.000e+00  2.286e+00  2.771e-01  4.197e-01
A  1.500e+00 -2.529e+00  1.002e+00  4.279e+01  2.700e+00  1.286e-01  4.200e-01
E  1.557e+00 -2.486e+00  1.028e+00  4.504e+01  2.586e+00  1.300e-01  4.001e-01
E  8.000e-01 -2.029e+00  1.049e+00  1.757e+01  1.586e+00  2.271e-01  3.937e-01
Q  9.857e-01 -2.414e+00  1.052e+00  6.306e+01  1.629e+00  2.157e-01  8.273e-01
G  8.000e-01 -2.029e+00  1.022e+00  1.757e+01  1.586e+00  2.271e-01  3.937e-01
Y  4.000e-01 -2.029e+00  9.835e-01  1.396e+01  1.457e+00  2.386e-01  2.939e-01
A  4.000e-01 -2.171e+00  9.583e-01  0.000e+00  2.286e+00  2.243e-01  3.123e-01
I  4.000e-01 -2.171e+00  9.543e-01  0.000e+00  2.286e+00  2.243e-01  3.123e-01
N  3.286e-01 -1.857e+00  9.766e-01  1.611e+00  2.286e+00  2.629e-01  3.550e-01
R  7.000e-01 -1.786e+00  9.959e-01  1.937e+01  2.171e+00  2.829e-01  3.494e-01
Q  5.857e-01 -1.771e+00  9.976e-01  0.000e+00  2.157e+00  2.914e-01  2.780e-01
A  5.857e-01 -1.871e+00  9.865e-01  5.889e+00  2.171e+00  2.957e-01  8.023e-01
S  9.857e-01 -2.014e+00  9.653e-01  1.188e+01  3.129e+00  2.700e-01  9.206e-01
M  6.000e-01 -1.486e+00  9.647e-01  0.000e+00  2.014e+00  3.871e-01  9.086e-01
L  1.000e+00 -1.543e+00  9.895e-01  3.323e+00  4.500e+00  3.529e-01  9.396e-01
R  1.500e+00 -2.357e+00  1.027e+00  3.455e+01  7.357e+00  1.714e-01  9.526e-01
S  1.500e+00 -2.357e+00  1.066e+00  3.455e+01  7.357e+00  1.714e-01  9.526e-01
K  1.614e+00 -3.086e+00  1.076e+00  5.508e+01  7.457e+00  6.571e-02  1.052e+00
K  1.657e+00 -3.029e+00  1.061e+00  5.135e+01  7.443e+00  5.143e-02  9.431e-01
S  9.714e-01 -1.743e+00  1.025e+00  0.000e+00  6.200e+00  2.357e-01  5.177e-01
H  9.286e-01 -1.686e+00  9.798e-01  0.000e+00  6.114e+00  2.529e-01  4.951e-01
V  3.143e-01 -8.571e-01  9.426e-01  0.000e+00  3.243e+00  4.429e-01  4.107e-01
I -3.714e-01  3.429e-01  9.140e-01  0.000e+00  3.429e-01  6.357e-01 -3.586e-02
G -6.714e-01  1.100e+00  8.980e-01  0.000e+00  2.143e-01  7.029e-01 -4.493e-01
M -6.000e-01  1.329e+00  8.999e-01  0.000e+00  3.000e-01  6.829e-01 -5.014e-01
I  4.286e-02  1.714e-01  9.213e-01  0.000e+00  3.200e+00  5.000e-01 -4.701e-01
I -2.857e-02 -6.571e-01  9.507e-01  0.000e+00  3.443e+00  4.129e-01 -5.114e-02
P  4.000e-01 -1.100e+00  9.924e-01  0.000e+00  3.743e+00  2.729e-01  6.800e-02
K  6.143e-01 -1.871e+00  1.026e+00  0.000e+00  4.000e+00  1.171e-01  1.300e-02
Y  1.300e+00 -3.157e+00  1.043e+00  5.123e+01  5.243e+00 -6.714e-02  4.384e-01
D  1.229e+00 -3.986e+00  1.052e+00  1.000e+02  5.486e+00 -1.543e-01  8.574e-01
N  8.714e-01 -3.357e+00  1.037e+00  7.006e+01  5.300e+00 -7.143e-03  8.449e-01
R  4.429e-01 -2.857e+00  1.016e+00  3.712e+01  2.443e+00  1.357e-01  7.891e-01
Y  8.143e-01 -2.786e+00  9.997e-01  3.156e+01  2.329e+00  1.557e-01  7.836e-01
F  1.286e-01 -1.643e+00  9.828e-01  0.000e+00  1.986e+00  3.457e-01  2.736e-01
G  2.857e-02 -8.857e-01  9.791e-01  0.000e+00  1.743e+00  4.929e-01  4.000e-01
S  2.857e-02 -7.429e-01  9.798e-01  0.000e+00  9.143e-01  5.071e-01  3.816e-01
I  7.857e-01 -1.200e+00  9.779e-01  0.000e+00  1.914e+00  4.100e-01  3.880e-01
A  7.857e-01 -1.200e+00  9.808e-01  0.000e+00  1.914e+00  4.100e-01  3.880e-01
E  1.214e+00 -1.643e+00  9.871e-01  0.000e+00  2.286e+00  2.900e-01  4.041e-01
R  1.600e+00 -2.029e+00  9.939e-01  0.000e+00  2.571e+00  1.871e-01  3.977e-01
F  1.671e+00 -2.400e+00  9.915e-01  2.086e+01  2.600e+00  1.843e-01  7.599e-01
E  1.671e+00 -2.400e+00  9.878e-01  2.086e+01  2.600e+00  1.843e-01  7.599e-01
E  1.671e+00 -2.543e+00  9.779e-01  2.471e+01  3.429e+00  1.700e-01  7.783e-01
M  1.671e+00 -2.400e+00  9.716e-01  2.086e+01  2.600e+00  1.843e-01  7.599e-01
A  2.457e+00 -3.443e+00  9.868e-01  6.351e+01  3.814e+00 -1.857e-02  7.883e-01
R  2.029e+00 -3.000e+00  1.007e+00  5.405e+01  3.443e+00  1.014e-01  7.721e-01
E  1.343e+00 -1.957e+00  1.023e+00  0.000e+00  3.043e+00  2.757e-01  8.894e-01
R  1.271e+00 -1.686e+00  1.028e+00  0.000e+00  3.029e+00  2.829e-01  1.052e+00
G  1.343e+00 -2.171e+00  1.015e+00  4.178e+00  3.200e+00  1.657e-01  1.028e+00
L  6.571e-01 -8.857e-01  9.862e-01  0.000e+00  1.957e+00  3.500e-01  6.021e-01
L -2.857e-02  2.571e-01  9.576e-01  0.000e+00  1.543e+00  5.200e-01  1.951e-01
P -5.143e-01  8.000e-01  9.356e-01  0.000e+00  4.571e-01  6.529e-01  1.804e-01
I -6.571e-01  1.214e+00  9.219e-01  0.000e+00  4.000e-01  6.786e-01  1.896e-01
I -4.571e-01  5.714e-01  9.276e-01  0.000e+00  5.429e-01  6.229e-01  7.600e-02
T  2.286e-01 -6.143e-01  9.467e-01  0.000e+00  1.771e+00  4.343e-01 -2.286e-02
C  6.571e-01 -1.029e+00  9.741e-01  0.000e+00  2.800e+00  3.786e-01 -7.000e-03
T  1.343e+00 -2.314e+00  1.005e+00  3.601e+00  4.043e+00  1.943e-01  4.184e-01
R  1.600e+00 -3.186e+00  1.025e+00  4.910e+01  4.257e+00  6.571e-02  8.280e-01
R  2.086e+00 -3.586e+00  1.037e+00  6.081e+01  4.514e+00 -5.286e-02  8.243e-01
R  1.971e+00 -3.400e+00  1.037e+00  6.792e+01  4.543e+00 -2.429e-02  9.486e-01
P  2.457e+00 -3.800e+00  1.026e+00  7.562e+01  4.800e+00 -1.429e-01  9.449e-01
E  1.771e+00 -2.514e+00  1.012e+00  1.915e+01  3.557e+00  4.143e-02  5.194e-01
L  1.771e+00 -2.371e+00  9.913e-01  1.530e+01  2.729e+00  5.571e-02  5.010e-01
E  1.271e+00 -1.471e+00  9.736e-01  0.000e+00  1.529e+00  2.286e-01  5.091e-01
I  1.057e+00 -6.429e-01  9.622e-01  0.000e+00  1.314e+00  3.471e-01  5.149e-01
E  1.057e+00 -7.000e-01  9.575e-01  0.000e+00  3.800e+00  3.243e-01  5.544e-01
A  1.243e+00 -9.857e-01  9.601e-01  0.000e+00  3.829e+00  3.086e-01  4.637e-01
V  6.286e-01 -2.143e-01  9.551e-01  0.000e+00  3.443e+00  4.757e-01  4.189e-01
K  6.286e-01 -3.143e-01  9.526e-01  0.000e+00  3.457e+00  4.800e-01  9.431e-01
A  2.429e-01  7.143e-02  9.382e-01  0.000e+00  3.171e+00  5.829e-01  9.496e-01
M -1.714e-01 -3.143e-01  9.218e-01  0.000e+00  3.171e+00  5.314e-01  9.169e-01
L  7.143e-02 -1.414e+00  9.193e-01  0.000e+00  3.586e+00  3.829e-01  9.171e-01
S -5.714e-01 -2.571e-01  9.160e-01  0.000e+00  6.857e-01  5.657e-01  8.859e-01
W -7.143e-02 -1.014e+00  9.216e-01  0.000e+00  9.857e-01  3.871e-01  9.623e-01
Q -3.714e-01 -1.414e+00  9.281e-01  0.000e+00  1.000e+00  3.271e-01  1.001e+00
V -3.286e-01 -1.357e+00  9.312e-01  0.000e+00  9.857e-01  3.129e-01  8.920e-01
D -5.857e-01 -6.429e-01  9.287e-01  0.000e+00  8.571e-01  3.700e-01  8.939e-01
W -1.714e-01 -2.571e-01  9.265e-01  0.000e+00  8.571e-01  4.214e-01  9.266e-01
V -2.571e-01  1.429e-01  9.332e-01  0.000e+00  6.000e-01  5.286e-01  9.217e-01
V -4.286e-02 -5.143e-01  9.462e-01  0.000e+00  6.429e-01  4.886e-01  8.973e-01
A -5.429e-01  2.429e-01  9.715e-01  0.000e+00  3.429e-01  6.671e-01  8.209e-01
T -1.143e-01  2.714e-01  1.002e+00  0.000e+00  4.571e-01  6.786e-01  8.307e-01
G  1.286e-01 -8.286e-01  1.029e+00  3.603e+01  7.429e-01  5.300e-01  7.226e-01
A  3.429e-01 -1.657e+00  1.049e+00  6.216e+01  9.571e-01  4.114e-01  7.169e-01
T  8.429e-01 -2.414e+00  1.060e+00  9.775e+01  1.257e+00  2.329e-01  7.933e-01
N  1.329e+00 -2.871e+00  1.066e+00  1.000e+02  4.000e+00  9.143e-02  8.291e-01
P  1.071e+00 -2.171e+00  1.061e+00  3.829e+01  3.957e+00  1.414e-01  4.383e-01
D  1.186e+00 -2.543e+00  1.047e+00  5.811e+01  4.043e+00  8.571e-02  4.181e-01
K  1.171e+00 -2.186e+00  1.028e+00  4.414e+01  3.929e+00  1.257e-01  4.410e-01
I  8.857e-01 -1.143e+00  9.973e-01  0.000e+00  3.657e+00  2.886e-01  6.581e-01
S  7.429e-01 -5.571e-01  9.658e-01  0.000e+00  3.429e+00  3.929e-01  6.486e-01
A  3.429e-01 -5.571e-01  9.491e-01  0.000e+00  3.500e+00  4.243e-01  5.541e-01
L -5.714e-02 -5.000e-01  9.430e-01  0.000e+00  1.014e+00  4.586e-01  5.231e-01
C  1.286e-01 -8.857e-01  9.544e-01  0.000e+00  1.057e+00  4.471e-01  9.567e-01
Q  8.571e-02 -8.286e-01  9.764e-01  0.000e+00  9.714e-01  4.643e-01  9.341e-01
Q -5.714e-02 -4.857e-01  9.890e-01  0.000e+00  9.286e-01  4.657e-01  9.159e-01
A  2.000e-01 -1.257e+00  1.000e+00  1.802e+01  1.129e+00  3.329e-01  8.011e-01
G  2.857e-01 -1.714e+00  1.004e+00  3.513e+01  1.300e+00  3.057e-01  8.119e-01
V  4.286e-02 -6.143e-01  1.009e+00  0.000e+00  8.857e-01  4.543e-01  8.116e-01
P  4.286e-02 -6.143e-01  1.014e+00  0.000e+00  7.571e-01  4.543e-01  7.031e-01
T -1.429e-01 -3.286e-01  1.007e+00  0.000e+00  7.286e-01  4.700e-01  7.939e-01
V  2.857e-01 -7.714e-01  9.931e-01  0.000e+00  1.029e+00  3.300e-01  9.130e-01
N  2.429e-01 -8.286e-01  9.741e-01  0.000e+00  1.043e+00  3.443e-01  1.022e+00
L  2.429e-01 -8.286e-01  9.680e-01  0.000e+00  1.043e+00  3.443e-01  1.022e+00
D  3.000e-01 -7.857e-01  9.802e-01  0.000e+00  9.286e-01  3.457e-01  1.002e+00
L  5.571e-01 -1.500e+00  1.007e+00  0.000e+00  1.057e+00  2.886e-01  1.000e+00
P  2.714e-01 -4.571e-01  1.035e+00  0.000e+00  7.857e-01  4.514e-01  1.217e+00
G  5.714e-01 -1.114e+00  1.051e+00  0.000e+00  9.000e-01  3.800e-01  1.107e+00
S  1.429e-01 -8.429e-01  1.050e+00  0.000e+00  7.714e-01  4.414e-01  1.006e+00
L  4.429e-01 -1.500e+00  1.043e+00  2.072e+01  8.857e-01  3.700e-01  8.953e-01
S  2.286e-01 -6.714e-01  1.032e+00  0.000e+00  6.714e-01  4.886e-01  9.010e-01
P -2.857e-02  2.857e-02  1.015e+00  0.000e+00  6.286e-01  5.386e-01  5.101e-01
S -2.857e-02  2.857e-02  1.002e+00  0.000e+00  6.286e-01  5.386e-01  5.101e-01
V  6.571e-01 -1.014e+00  9.884e-01  1.937e+01  9.571e-01  3.443e-01  4.959e-01
I  6.429e-01 -1.400e+00  9.823e-01  2.162e+01  1.114e+00  2.529e-01  3.896e-01
S  3.143e-01 -1.357e+00  9.901e-01  3.601e+00  1.143e+00  2.943e-01  3.990e-01
D  2.714e-01 -1.300e+00  9.981e-01  0.000e+00  1.057e+00  3.114e-01  3.764e-01
N  4.857e-01 -1.957e+00  1.008e+00  4.234e+01  1.100e+00  2.714e-01  3.520e-01
Y  6.714e-01 -2.343e+00  1.014e+00  8.784e+01  1.143e+00  2.600e-01  7.856e-01
G  1.057e+00 -2.786e+00  1.023e+00  8.423e+01  3.914e+00  1.343e-01  8.187e-01
G  5.571e-01 -2.029e+00  1.025e+00  4.865e+01  3.614e+00  3.129e-01  7.423e-01
A  2.714e-01 -9.857e-01  1.022e+00  0.000e+00  3.343e+00  4.757e-01  9.594e-01
K  5.429e-01 -9.000e-01  1.011e+00  7.655e+00  3.257e+00  5.114e-01  9.511e-01
A  4.714e-01 -1.300e+00  9.882e-01  0.000e+00  3.343e+00  4.529e-01  1.022e+00
L  9.000e-01 -1.800e+00  9.788e-01  9.311e+00  6.200e+00  3.100e-01  1.078e+00
T  7.143e-01 -1.414e+00  9.700e-01  0.000e+00  6.157e+00  3.214e-01  6.441e-01
H  2.857e-02 -3.143e-01  9.671e-01  0.000e+00  3.271e+00  5.186e-01  7.219e-01
K  2.857e-02 -3.143e-01  9.667e-01  0.000e+00  3.271e+00  5.186e-01  7.219e-01
I  3.143e-01 -1.357e+00  9.561e-01  0.000e+00  3.543e+00  3.557e-01  5.047e-01
L  4.143e-01 -1.371e+00  9.596e-01  0.000e+00  3.514e+00  3.400e-01  5.074e-01
A  4.143e-01 -6.571e-01  9.714e-01  0.000e+00  3.429e+00  4.371e-01  4.793e-01
N  4.143e-01 -7.429e-01  9.906e-01  0.000e+00  1.771e+00  4.457e-01  4.581e-01
S  1.100e+00 -2.029e+00  1.015e+00  1.316e+01  3.014e+00  2.614e-01  8.836e-01
A  1.786e+00 -3.214e+00  1.029e+00  6.622e+01  4.243e+00  7.286e-02  7.847e-01
R  1.857e+00 -3.529e+00  1.042e+00  8.243e+01  4.243e+00  3.429e-02  7.420e-01
R  2.257e+00 -3.529e+00  1.050e+00  8.604e+01  4.371e+00  2.286e-02  8.419e-01
R  1.957e+00 -2.871e+00  1.051e+00  2.685e+01  4.257e+00  9.429e-02  9.527e-01
G  1.957e+00 -2.871e+00  1.048e+00  2.685e+01  4.257e+00  9.429e-02  9.527e-01
E  1.529e+00 -2.457e+00  1.024e+00  1.701e+01  3.229e+00  1.500e-01  9.369e-01
L  8.429e-01 -1.271e+00  9.964e-01  0.000e+00  2.000e+00  3.386e-01  1.036e+00
A  3.571e-01 -7.286e-01  9.716e-01  0.000e+00  9.143e-01  4.714e-01  1.021e+00
P  4.441e-16 -2.714e-01  9.503e-01  0.000e+00  9.000e-01  5.400e-01  1.027e+00
L -6.857e-01  8.714e-01  9.397e-01  0.000e+00  4.857e-01  7.100e-01  6.201e-01
T -4.286e-01  2.714e-01  9.381e-01  0.000e+00  5.143e-01  6.557e-01  4.867e-01
F -3.571e-01 -4.286e-02  9.511e-01  0.000e+00  5.143e-01  6.171e-01  4.440e-01
I  7.143e-02 -4.571e-01  9.742e-01  0.000e+00  1.543e+00  5.614e-01  4.599e-01
G  7.571e-01 -1.643e+00  1.008e+00  0.000e+00  2.771e+00  3.729e-01  3.610e-01
G  7.429e-01 -1.286e+00  1.038e+00  0.000e+00  2.657e+00  4.129e-01  3.839e-01
R  1.043e+00 -1.786e+00  1.041e+00  1.576e+01  2.786e+00  3.429e-01  3.976e-01
R  1.043e+00 -1.786e+00  1.034e+00  1.576e+01  2.786e+00  3.429e-01  3.976e-01
A  9.857e-01 -1.829e+00  1.020e+00  1.351e+01  2.900e+00  3.414e-01  4.174e-01
T  9.857e-01 -2.000e+00  1.009e+00  1.658e+01  3.071e+00  2.629e-01  4.361e-01
I  4.857e-01 -1.100e+00  1.018e+00  0.000e+00  1.871e+00  4.357e-01  4.443e-01
T  1.000e-01 -5.714e-01  1.024e+00  0.000e+00  7.571e-01  5.529e-01  4.323e-01
P -4.286e-02 -2.286e-01  1.020e+00  0.000e+00  7.143e-01  5.543e-01  4.140e-01
A -3.143e-01 -3.143e-01  9.989e-01  0.000e+00  8.000e-01  5.186e-01  4.223e-01
S -1.286e-01 -7.000e-01  9.614e-01  0.000e+00  8.429e-01  5.071e-01  8.559e-01
V -1.429e-01 -3.429e-01  9.303e-01  0.000e+00  7.286e-01  5.471e-01  8.787e-01
Y -1.000e-01 -2.286e-01  9.145e-01  0.000e+00  6.429e-01  6.086e-01  8.826e-01
A -8.571e-02 -5.857e-01  9.276e-01  5.403e+00  7.571e-01  5.686e-01  8.597e-01
A -3.143e-01 -2.000e-01  9.534e-01  0.000e+00  6.571e-01  6.329e-01  8.084e-01
S  3.286e-01 -1.443e+00  9.749e-01  9.311e+00  1.900e+00  4.586e-01  8.186e-01
T  4.000e-01 -6.143e-01  9.792e-01  0.000e+00  1.657e+00  5.457e-01  3.996e-01
M  4.000e-01 -6.143e-01  9.635e-01  0.000e+00  1.657e+00  5.457e-01  3.996e-01
R  5.143e-01 -9.857e-01  9.429e-01  0.000e+00  1.743e+00  4.900e-01  3.794e-01
I -1.429e-02 -1.000e+00  9.266e-01  0.000e+00  1.657e+00  4.943e-01  3.669e-01
A  4.286e-02 -9.571e-01  9.219e-01  0.000e+00  1.543e+00  4.957e-01  3.470e-01
S -2.857e-02 -6.857e-01  9.248e-01  0.000e+00  1.529e+00  5.029e-01  5.091e-01
W -5.286e-01  2.143e-01  9.273e-01  0.000e+00  3.286e-01  6.757e-01  5.173e-01
G -4.143e-01 -7.143e-02  9.253e-01  0.000e+00  3.143e-01  6.514e-01  9.173e-01
L  8.571e-02 -9.714e-01  9.279e-01  0.000e+00  1.514e+00  4.786e-01  9.091e-01
A  4.714e-01 -1.500e+00  9.344e-01  0.000e+00  2.629e+00  3.614e-01  9.211e-01
C  1.386e+00 -2.014e+00  9.513e-01  0.000e+00  3.829e+00  2.400e-01  9.457e-01
R  1.129e+00 -1.314e+00  9.721e-01  0.000e+00  3.786e+00  2.900e-01  5.549e-01
R  1.029e+00 -1.457e+00  9.791e-01  0.000e+00  3.800e+00  3.043e-01  4.276e-01
R  6.143e-01 -1.843e+00  9.667e-01  0.000e+00  3.800e+00  2.529e-01  3.949e-01
I  5.000e-01 -1.657e+00  9.416e-01  0.000e+00  3.829e+00  2.814e-01  5.191e-01
F  7.143e-02 -1.243e+00  9.181e-01  0.000e+00  2.800e+00  3.371e-01  5.033e-01
W -4.286e-01 -3.429e-01  9.037e-01  0.000e+00  1.600e+00  5.100e-01  5.114e-01
L -1.114e+00  9.429e-01  9.096e-01  0.000e+00  3.571e-01  6.943e-01  8.600e-02
P -4.286e-01 -3.429e-01  9.238e-01  0.000e+00  1.600e+00  5.100e-01  5.114e-01
A  3.571e-01 -1.300e+00  9.449e-01  0.000e+00  4.471e+00  2.986e-01  5.610e-01
I  7.714e-01 -9.143e-01  9.700e-01  0.000e+00  4.471e+00  3.500e-01  5.937e-01
R  9.714e-01 -1.557e+00  9.921e-01  0.000e+00  4.614e+00  2.943e-01  4.801e-01
K  7.143e-01 -7.857e-01  1.006e+00  0.000e+00  4.414e+00  4.271e-01  5.949e-01
A  1.214e+00 -1.686e+00  1.008e+00  0.000e+00  5.614e+00  2.543e-01  5.867e-01
T  1.414e+00 -2.429e+00  1.004e+00  4.054e+01  5.771e+00  2.029e-01  9.974e-01
L  9.143e-01 -1.529e+00  9.979e-01  1.017e+01  4.571e+00  3.757e-01  1.006e+00
R  3.429e-01 -6.143e-01  9.903e-01  0.000e+00  1.657e+00  5.443e-01  9.590e-01
T  8.429e-01 -1.514e+00  9.861e-01  0.000e+00  2.857e+00  3.714e-01  9.509e-01
A  9.429e-01 -1.529e+00  9.887e-01  0.000e+00  2.829e+00  3.557e-01  9.536e-01
C  1.200e+00 -2.129e+00  9.965e-01  6.171e+01  2.857e+00  3.014e-01  8.201e-01
R  5.143e-01 -9.429e-01  1.015e+00  1.349e+00  1.629e+00  4.900e-01  9.190e-01
S  5.000e-01 -5.857e-01  1.025e+00  0.000e+00  1.514e+00  5.300e-01  9.419e-01
G  5.000e-01 -5.857e-01  1.014e+00  0.000e+00  1.514e+00  5.300e-01  9.419e-01
L  1.071e+00 -1.586e+00  9.958e-01  0.000e+00  2.771e+00  3.700e-01  9.673e-01
A  1.071e+00 -1.586e+00  9.773e-01  0.000e+00  2.771e+00  3.700e-01  9.673e-01
A  1.457e+00 -2.114e+00  9.758e-01  3.281e-01  3.886e+00  2.529e-01  9.793e-01
R  1.314e+00 -1.700e+00  9.839e-01  0.000e+00  3.829e+00  2.786e-01  9.884e-01
R  1.429e+00 -1.886e+00  9.836e-01  1.802e+01  3.800e+00  2.500e-01  8.641e-01
R  1.929e+00 -2.786e+00  9.779e-01  2.748e+01  5.000e+00  7.714e-02  8.560e-01
C  2.000e+00 -3.100e+00  9.645e-01  4.369e+01  5.000e+00  3.857e-02  8.133e-01
C  1.243e+00 -2.643e+00  9.586e-01  1.621e+01  4.000e+00  1.357e-01  8.069e-01
R  5.571e-01 -1.457e+00  9.648e-01  0.000e+00  2.771e+00  3.243e-01  9.057e-01
G -1.286e-01 -2.714e-01  9.674e-01  0.000e+00  1.543e+00  5.129e-01  1.005e+00
Y -4.286e-02 -7.286e-01  9.698e-01  0.000e+00  1.714e+00  4.857e-01  1.015e+00
L  5.286e-01 -1.729e+00  9.756e-01  0.000e+00  2.971e+00  3.257e-01  1.041e+00
L  5.286e-01 -1.729e+00  9.854e-01  0.000e+00  2.971e+00  3.257e-01  1.041e+00
T  2.000e-01 -1.857e+00  9.994e-01  2.300e+01  3.171e+00  2.886e-01  1.069e+00
R  5.286e-01 -1.900e+00  1.005e+00  2.086e+01  3.143e+00  2.471e-01  1.059e+00
R  3.000e-01 -2.571e+00  9.976e-01  3.583e+01  3.171e+00  1.800e-01  9.360e-01
Y  9.857e-01 -3.671e+00  9.864e-01  7.989e+01  6.057e+00 -1.714e-02  8.583e-01
P  1.043e+00 -3.629e+00  9.804e-01  5.936e+01  5.943e+00 -1.571e-02  8.384e-01
W  3.571e-01 -2.443e+00  9.836e-01  1.616e+01  4.714e+00  1.729e-01  9.373e-01
K -2.143e-01 -1.443e+00  9.938e-01  0.000e+00  3.457e+00  3.329e-01  9.119e-01
G  4.286e-02 -1.000e+00  9.922e-01  0.000e+00  3.257e+00  4.086e-01  9.264e-01
L  4.286e-02 -8.286e-01  9.781e-01  0.000e+00  3.086e+00  4.871e-01  9.077e-01
C  3.857e-01 -3.429e-01  9.621e-01  0.000e+00  3.029e+00  5.257e-01  9.069e-01
A  3.857e-01 -4.286e-01  9.525e-01  0.000e+00  1.371e+00  5.343e-01  8.857e-01
G  8.143e-01 -1.014e+00  9.566e-01  0.000e+00  2.571e+00  4.000e-01  9.203e-01
C  5.857e-01 -1.686e+00  9.677e-01  0.000e+00  2.600e+00  3.329e-01  7.969e-01
R  5.143e-01 -1.443e+00  9.768e-01  1.171e+01  2.614e+00  3.471e-01  8.121e-01
R  0.000e+00  0.000e+00  0.000e+00  0.000e+00  0.000e+00  0.000e+00  0.000e+00
W  0.000e+00  0.000e+00  0.000e+00  0.000e+00  0.000e+00  0.000e+00  0.000e+00
V  0.000e+00  0.000e+00  0.000e+00  0.000e+00  0.000e+00  0.000e+00  0.000e+00

#!/usr/bin/env python
# ================================================================================
#
#                             COPYRIGHT NOTICE
#
#                Centre National de la Recherche Scientifique
#                                   CNRS
#
#                Institut de Biologie et Chimie des Proteines
#                             IBCP CNRS UMR 5086
#                            7 passage du Vercors
#                             69007 Lyon, FRANCE
#
#  This software/database is covered by copyright of CNRS IBCP
#  All rights reserved. Reproduction and usage of this software/database are 
#  strictly restricted, and need a prior written permission from CNRS IBCP
#  (see "Contact" below).
#
#  CNRS IBCP do not and cannot warrant the performance or results that
#  may be obtained by using this software or data. CNRS IBCP disclaim all
#  warranties, express or implied, including warranties of performance,
#  merchantability or fitness for any particular purpose.
#
# ================================================================================
#
# Author: Christophe Blanchet
#
# Contact: Christophe.Blanchet@ibcp.fr
#
# First Version Creation Date:   18/11/2008
#
# $Revision: 1.0 $
#
# File Description: 
#
#
# Modifications:
# --------------------------------------------------------------------------
# Date     Name        Description of modification
# -------  ----------  -----------------------------------------------------
#
# ================================================================================
import sys
import time
from PcProf_Service_client import *

fn_input = 'benchy_seq001.seq'
fn_control = 'control-seq001.PcProf'
ret = 0

# get a port proxy instance
loc = PcProf_ServiceLocator()
port = loc.getPcProfPort()

###
# submit a new request
# create
req = submitPcProfRequest()
fp_input = open (fn_input, 'r')
req._Sequence = fp_input.read()

# call the remote method
resp = port.submitPcProf(req)
jobid = resp._JobId
#print jobid
if not jobid:
	ret = 1

###
# check status
# while status different of 'done' or 'aborted', check again
status = 'init'
req = checkStatusPcProfRequest()
req._JobId = jobid
while status not in ('done','aborted'):
	time.sleep(2) 
	resp = port.checkStatusPcProf(req)
	status = resp._Status
	#print status
if status != 'done':
	ret = 1

###
# get results
req = getResultsPcProfRequest()
req._JobId = jobid
resp = port.getResultsPcProf(req)

# write result
#open(fn_control,'w').write(resp._PhysicoChemProfile)

#compare result with ref
resultcontrol = open(fn_control, 'r').read()
if resp._PhysicoChemProfile != resultcontrol:
	ret = 1
	#print "wooohh"

#print ret
sys.exit (ret)

##################################################
# file: PcProf_Service_client.py
# 
# client stubs generated by "ZSI.generate.wsdl2python.WriteServiceModule"
#     /usr/local/bin/wsdl2py http://gbio-pbil.ibcp.fr/ws/PcProfWS.wsdl
# 
##################################################


import urlparse, types
from ZSI.TCcompound import ComplexType, Struct
from ZSI import client
from ZSI.schema import GED, GTD
import ZSI

# Locator
class PcProf_ServiceLocator:
    PcProfPort_address = "http://gbio.ibcp.fr:8090/PcProf_Service"
    def getPcProfPortAddress(self):
        return PcProf_ServiceLocator.PcProfPort_address
    def getPcProfPort(self, url=None, **kw):
        return PcProfBindingSOAP(url or PcProf_ServiceLocator.PcProfPort_address, **kw)

# Methods
class PcProfBindingSOAP:
    def __init__(self, url, **kw):
        kw.setdefault("readerclass", None)
        kw.setdefault("writerclass", None)
        # no resource properties
        self.binding = client.Binding(url=url, **kw)
        # no ws-addressing

    # op: submitPcProf
    def submitPcProf(self, request, **kw):
        if isinstance(request, submitPcProfRequest) is False:
            raise TypeError, "%s incorrect request type" % (request.__class__)
        # no input wsaction
        self.binding.Send(None, None, request, soapaction="urn:PcProfWS.wsdl#submitPcProf", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
        # no output wsaction
        typecode = Struct(pname=None, ofwhat=submitPcProfResponse.typecode.ofwhat, pyclass=submitPcProfResponse.typecode.pyclass)
        response = self.binding.Receive(typecode)
        return response

    # op: checkStatusPcProf
    def checkStatusPcProf(self, request, **kw):
        if isinstance(request, checkStatusPcProfRequest) is False:
            raise TypeError, "%s incorrect request type" % (request.__class__)
        # no input wsaction
        self.binding.Send(None, None, request, soapaction="urn:PcProfWS.wsdl#checkStatusPcProf", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
        # no output wsaction
        typecode = Struct(pname=None, ofwhat=checkStatusPcProfResponse.typecode.ofwhat, pyclass=checkStatusPcProfResponse.typecode.pyclass)
        response = self.binding.Receive(typecode)
        return response

    # op: getResultsPcProf
    def getResultsPcProf(self, request, **kw):
        if isinstance(request, getResultsPcProfRequest) is False:
            raise TypeError, "%s incorrect request type" % (request.__class__)
        # no input wsaction
        self.binding.Send(None, None, request, soapaction="urn:PcProfWS.wsdl#getResultsPcProf", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
        # no output wsaction
        typecode = Struct(pname=None, ofwhat=getResultsPcProfResponse.typecode.ofwhat, pyclass=getResultsPcProfResponse.typecode.pyclass)
        response = self.binding.Receive(typecode)
        return response

    # op: cancelPcProf
    def cancelPcProf(self, request, **kw):
        if isinstance(request, cancelPcProfRequest) is False:
            raise TypeError, "%s incorrect request type" % (request.__class__)
        # no input wsaction
        self.binding.Send(None, None, request, soapaction="urn:PcProfWS.wsdl#cancelPcProf", encodingStyle="http://schemas.xmlsoap.org/soap/encoding/", **kw)
        # no output wsaction
        typecode = Struct(pname=None, ofwhat=cancelPcProfResponse.typecode.ofwhat, pyclass=cancelPcProfResponse.typecode.pyclass)
        response = self.binding.Receive(typecode)
        return response

class submitPcProfRequest:
    def __init__(self, **kw):
        """Keyword parameters:
        Sequence -- part Sequence
        """
        self._Sequence =  kw.get("Sequence")
submitPcProfRequest.typecode = Struct(pname=("urn:PcProf_Service","submitPcProf"), ofwhat=[ZSI.TC.String(pname="Sequence", aname="_Sequence", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=submitPcProfRequest, encoded="urn:PcProf_Service")

class submitPcProfResponse:
    def __init__(self, **kw):
        """Keyword parameters:
        JobId -- part JobId
        """
        self._JobId =  kw.get("JobId")
submitPcProfResponse.typecode = Struct(pname=("urn:PcProf_Service","submitPcProfResponse"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=submitPcProfResponse, encoded="urn:PcProf_Service")

class checkStatusPcProfRequest:
    def __init__(self, **kw):
        """Keyword parameters:
        JobId -- part JobId
        """
        self._JobId =  kw.get("JobId")
checkStatusPcProfRequest.typecode = Struct(pname=("urn:PcProf_Service","checkStatusPcProf"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=checkStatusPcProfRequest, encoded="urn:PcProf_Service")

class checkStatusPcProfResponse:
    def __init__(self, **kw):
        """Keyword parameters:
        Status -- part Status
        """
        self._Status =  kw.get("Status")
checkStatusPcProfResponse.typecode = Struct(pname=("urn:PcProf_Service","checkStatusPcProfResponse"), ofwhat=[ZSI.TC.String(pname="Status", aname="_Status", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=checkStatusPcProfResponse, encoded="urn:PcProf_Service")

class getResultsPcProfRequest:
    def __init__(self, **kw):
        """Keyword parameters:
        JobId -- part JobId
        """
        self._JobId =  kw.get("JobId")
getResultsPcProfRequest.typecode = Struct(pname=("urn:PcProf_Service","getResultsPcProf"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=getResultsPcProfRequest, encoded="urn:PcProf_Service")

class getResultsPcProfResponse:
    def __init__(self, **kw):
        """Keyword parameters:
        PhysicoChemProfile -- part PhysicoChemProfile
        """
        self._PhysicoChemProfile =  kw.get("PhysicoChemProfile")
getResultsPcProfResponse.typecode = Struct(pname=("urn:PcProf_Service","getResultsPcProfResponse"), ofwhat=[ZSI.TC.String(pname="PhysicoChemProfile", aname="_PhysicoChemProfile", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=getResultsPcProfResponse, encoded="urn:PcProf_Service")

class cancelPcProfRequest:
    def __init__(self, **kw):
        """Keyword parameters:
        JobId -- part JobId
        """
        self._JobId =  kw.get("JobId")
cancelPcProfRequest.typecode = Struct(pname=("urn:PcProf_Service","cancelPcProf"), ofwhat=[ZSI.TC.String(pname="JobId", aname="_JobId", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=cancelPcProfRequest, encoded="urn:PcProf_Service")

class cancelPcProfResponse:
    def __init__(self, **kw):
        """Keyword parameters:
        Status -- part Status
        """
        self._Status =  kw.get("Status")
cancelPcProfResponse.typecode = Struct(pname=("urn:PcProf_Service","cancelPcProfResponse"), ofwhat=[ZSI.TC.String(pname="Status", aname="_Status", typed=False, encoded=None, minOccurs=1, maxOccurs=1, nillable=True)], pyclass=cancelPcProfResponse, encoded="urn:PcProf_Service")

##################################################
# file: PcProf_Service_types.py
#
# schema types generated by "ZSI.generate.wsdl2python.WriteServiceModule"
#    /usr/local/bin/wsdl2py http://gbio-pbil.ibcp.fr/ws/PcProfWS.wsdl
#
##################################################

import ZSI
import ZSI.TCcompound
from ZSI.schema import LocalElementDeclaration, ElementDeclaration, TypeDefinition, GTD, GED