test1
This is a test of the EMBOSS prophet service.
Test filesDownload the files for this test
Test runRun test now
Support reference#1655-1676
derived from EMBOSS QA tests
Show/hide recent test logs
view log 1 week agoFAILED
Test began: 2013-06-11 22:05:02 Test ended: 2013-06-11 22:05:02 Result : Test failure ------ stderr and stdout follow ------ Retriving and processing the WSDL and the XSDs imported Caught an exception Could not create file parser context for file "http://www.ebi.ac.uk/soaplab/typed/services/nucleic_profiles.prophet?wsdl": Resource temporarily unavailable at ./prophet.pl line 21.Download this log...
view log 1 week agoFAILED
Test began: 2013-06-11 19:15:49 Test ended: 2013-06-11 19:16:04 Result : Test failure ------ stderr and stdout follow ------ Retriving and processing the WSDL and the XSDs imported Caught an exception Could not create file parser context for file "http://www.ebi.ac.uk/soaplab/typed/services/nucleic_profiles.prophet?wsdl": Resource temporarily unavailable at ./prophet.pl line 21.Download this log...
view log 1 month agoFAILED
Test began: 2013-05-16 10:15:19 Test ended: 2013-05-16 10:15:20 Result : Test failure ------ stderr and stdout follow ------ Retriving and processing the WSDL and the XSDs imported Caught an exception Could not create file parser context for file "http://www.ebi.ac.uk/soaplab/typed/services/nucleic_profiles.prophet?wsdl": Resource temporarily unavailable at ./prophet.pl line 21.Download this log...
view log 1 month agoFAILED
Test began: 2013-05-14 23:56:05 Test ended: 2013-05-14 23:56:06 Result : Test failure ------ stderr and stdout follow ------ Retriving and processing the WSDL and the XSDs imported Caught an exception Could not create file parser context for file "http://www.ebi.ac.uk/soaplab/typed/services/nucleic_profiles.prophet?wsdl": Resource temporarily unavailable at ./prophet.pl line 21.Download this log...
view log 1 month agoFAILED
Test began: 2013-05-11 03:09:11 Test ended: 2013-05-11 03:09:12 Result : Test failure ------ stderr and stdout follow ------ Retriving and processing the WSDL and the XSDs imported Caught an exception Could not create file parser context for file "http://www.ebi.ac.uk/soaplab/typed/services/nucleic_profiles.prophet?wsdl": Resource temporarily unavailable at ./prophet.pl line 21.Download this log...
view log 2 months agoFAILED
Test began: 2013-04-22 10:51:32 Test ended: 2013-04-22 10:51:32 Result : Test failure ------ stderr and stdout follow ------ Retriving and processing the WSDL and the XSDs imported Caught an exception Could not create file parser context for file "http://www.ebi.ac.uk/soaplab/typed/services/nucleic_profiles.prophet?wsdl": Resource temporarily unavailable at ./prophet.pl line 21.Download this log...
view log 2 months agoFAILED
Test began: 2013-04-20 14:12:01 Test ended: 2013-04-20 14:12:17 Result : Test failure ------ stderr and stdout follow ------ Retriving and processing the WSDL and the XSDs imported Caught an exception Could not create file parser context for file "http://www.ebi.ac.uk/soaplab/typed/services/nucleic_profiles.prophet?wsdl": Resource temporarily unavailable at ./prophet.pl line 21.Download this log...
view log 2 months agoFAILED
Test began: 2013-04-09 20:57:08 Test ended: 2013-04-09 20:57:09 Result : Test failure ------ stderr and stdout follow ------ Retriving and processing the WSDL and the XSDs imported Caught an exception Could not create file parser context for file "http://www.ebi.ac.uk/soaplab/typed/services/nucleic_profiles.prophet?wsdl": Resource temporarily unavailable at ./prophet.pl line 21.Download this log...
view log 3 months agoFAILED
Test began: 2013-03-07 07:35:14 Test ended: 2013-03-07 07:35:14 Result : Test failure ------ stderr and stdout follow ------ Retriving and processing the WSDL and the XSDs imported Caught an exception Could not create file parser context for file "http://www.ebi.ac.uk/soaplab/typed/services/nucleic_profiles.prophet?wsdl": Resource temporarily unavailable at ./prophet.pl line 21Download this log...
view log 3 months agoFAILED
Test began: 2013-03-06 22:43:21 Test ended: 2013-03-06 22:43:21 Result : Test failure ------ stderr and stdout follow ------ Retriving and processing the WSDL and the XSDs imported Caught an exception Could not create file parser context for file "http://www.ebi.ac.uk/soaplab/typed/services/nucleic_profiles.prophet?wsdl": Resource temporarily unavailable at ./prophet.pl line 21Download this log...
This test consists of the following files:
globins.gribskov
# Gribskov Protein Profile # Columns are amino acids A->Z # Last column is indel penalty # Rows are alignment positions 1->n Gribskov Name globins Matrix pprofile Length 164 Max_score 645.45 Threshold 75 Gap_open 3.00 Gap_extend 0.30 Consensus PIVDTGSVVSLSEEELSAVDKAWVKANSVAEVGGHALERGLFASEPMTLEFFDTFKYLSTFDLSKGSADVKAHGKKVLDALGDAVAHLDDLEGTLAALSDLHAHKLKKGVDPVNFKLLSHCLLVVLASHLPGDFTPEVQASMDKFLASVATVLASKYRELGYQG 0.15 0.00 0.03 0.03 0.03 -0.18 0.09 0.06 -0.06 0.00 0.03 -0.09 -0.06 0.00 0.00 0.45 0.09 0.09 0.12 0.09 0.00 0.03 -0.24 0.00 -0.24 0.00 0.87 0.87 0.00 0.00 0.06 -0.06 -0.06 0.18 -0.09 -0.09 0.45 0.00 -0.06 0.24 0.18 -0.09 0.00 -0.06 -0.09 -0.09 -0.03 0.06 0.00 0.33 -0.15 0.00 0.03 0.00 0.87 0.87 0.06 0.00 0.06 -0.06 -0.06 0.06 0.06 -0.09 0.33 0.00 -0.06 0.24 0.18 -0.09 0.00 0.03 -0.06 -0.09 -0.03 0.06 0.00 0.45 -0.24 0.00 -0.03 0.00 0.87 0.87 0.09 0.00 -0.15 0.45 0.30 -0.30 0.18 0.12 -0.06 0.00 0.09 -0.15 -0.12 0.18 0.00 0.03 0.18 0.00 0.06 0.06 0.00 -0.06 -0.33 0.00 -0.15 0.00 0.87 0.87 0.12 0.00 0.06 0.06 0.06 -0.09 0.12 -0.03 0.06 0.00 0.06 -0.03 0.00 0.06 0.00 0.09 -0.03 -0.03 0.09 0.45 0.00 0.06 -0.18 0.00 -0.09 0.00 0.87 0.87 0.18 0.00 0.06 0.18 0.15 -0.18 0.45 -0.06 -0.09 0.00 -0.03 -0.15 -0.09 0.12 0.00 0.09 0.06 -0.09 0.18 0.12 0.00 0.06 -0.30 0.00 -0.18 0.00 0.87 0.87 0.12 0.00 0.18 0.06 0.06 -0.09 0.18 -0.06 -0.03 0.00 0.06 -0.12 -0.09 0.09 0.00 0.12 -0.03 0.03 0.45 0.09 0.00 -0.03 0.09 0.00 -0.12 0.00 0.87 0.87 0.13 0.00 0.13 -0.13 -0.13 0.13 0.13 -0.19 0.69 0.00 -0.13 0.50 0.38 -0.19 0.00 0.06 -0.13 -0.19 -0.06 0.13 0.00 0.94 -0.50 0.00 -0.06 0.00 0.87 0.87 0.59 0.00 -0.06 -0.07 -0.02 0.24 0.31 -0.25 0.68 0.00 -0.20 0.72 0.60 -0.14 0.00 0.14 -0.03 -0.39 0.03 0.23 0.00 0.97 -0.55 0.00 -0.12 0.00 0.87 0.87 0.52 0.00 0.12 0.35 0.35 -0.54 0.38 0.41 -0.22 0.00 0.20 -0.30 -0.22 0.31 0.00 0.76 0.53 0.27 0.61 0.20 0.00 -0.08 -0.38 0.00 -0.48 0.00 0.87 0.87 0.01 0.00 -0.88 -0.10 0.24 0.83 -0.26 -0.04 0.62 0.00 -0.16 1.19 0.96 -0.18 0.00 -0.22 0.11 -0.34 -0.28 -0.02 0.00 0.62 0.07 0.00 0.09 0.00 0.87 0.87 0.54 0.00 0.44 0.37 0.34 -0.45 0.94 -0.20 -0.08 0.00 0.14 -0.40 -0.25 0.35 0.00 0.41 -0.02 -0.08 1.07 0.80 0.00 0.08 -0.38 0.00 -0.51 0.00 0.87 0.87 0.82 0.00 -0.13 0.71 0.92 -0.68 0.80 0.16 -0.20 0.00 0.14 -0.34 -0.20 0.38 0.00 0.56 0.45 -0.09 0.42 0.36 0.00 0.03 -1.13 0.00 -0.61 0.00 0.87 0.87 0.37 0.00 -0.47 0.17 0.38 -0.05 0.14 0.07 -0.26 0.00 0.19 -0.05 -0.22 0.21 0.00 -0.01 0.13 0.35 0.52 0.05 0.00 -0.30 -0.16 0.00 0.01 0.00 0.87 0.87 0.41 0.00 -0.61 0.90 1.26 -0.71 0.55 0.42 0.25 0.00 0.31 0.13 0.15 0.40 0.00 0.26 1.04 0.04 0.05 0.19 0.00 0.49 -1.41 0.00 -0.69 0.00 4.55 4.55 0.13 0.00 -1.04 -0.15 0.01 0.48 -0.39 -0.11 0.51 0.00 0.83 0.99 1.12 -0.01 0.00 -0.10 0.23 0.20 -0.13 0.12 0.00 0.54 0.36 0.00 -0.23 0.00 4.55 4.55 1.00 0.00 0.64 0.24 0.24 -0.41 0.81 -0.30 0.35 0.00 0.13 -0.08 -0.01 0.24 0.00 0.58 -0.09 -0.17 1.23 0.86 0.00 0.56 -0.52 0.00 -0.50 0.00 4.55 4.55 1.09 0.00 -0.33 0.08 0.18 -0.09 0.21 -0.09 0.27 0.00 0.33 0.48 0.58 0.07 0.00 0.55 0.27 -0.09 0.23 0.35 0.00 0.48 -0.45 0.00 -0.42 0.00 4.55 4.55 0.81 0.00 0.28 0.11 0.11 0.02 0.25 0.19 0.96 0.00 -0.14 0.57 0.42 0.00 0.00 0.30 0.09 -0.24 0.04 0.33 0.00 1.16 -1.02 0.00 -0.07 0.00 4.55 4.55 0.18 0.00 -0.48 0.64 0.44 -0.46 0.23 0.20 0.36 0.00 0.51 0.16 0.35 0.23 0.00 0.18 0.36 0.36 0.10 0.44 0.00 0.49 -0.41 0.00 -0.54 0.00 4.55 4.55 0.54 0.00 -0.30 0.00 0.00 -0.24 0.14 -0.11 -0.31 0.00 0.85 -0.20 -0.13 0.31 0.00 0.17 0.07 0.74 1.03 0.20 0.00 -0.32 0.34 0.00 -0.23 0.00 4.55 4.55 1.15 0.00 0.04 0.11 0.19 -0.01 0.45 -0.22 0.41 0.00 0.00 0.45 0.45 0.10 0.00 0.39 0.02 -0.39 0.45 0.98 0.00 0.54 -0.54 0.00 -0.27 0.00 4.55 4.55 -0.59 0.00 -1.37 -0.55 -0.60 0.59 -0.70 0.19 -0.64 0.00 0.77 0.14 -0.34 0.60 0.00 -0.65 -0.10 1.43 0.47 -0.35 0.00 -0.90 1.17 0.00 0.70 0.00 4.55 4.55 0.84 0.00 0.10 0.51 0.46 -0.41 0.84 -0.17 0.76 0.00 -0.08 0.37 0.31 0.10 0.00 0.33 0.15 -0.39 0.23 0.43 0.00 1.25 -1.48 0.00 -0.47 0.00 4.55 4.55 0.29 0.00 -0.79 0.77 1.01 -1.00 0.24 0.34 -0.33 0.00 1.52 -0.50 0.03 0.60 0.00 0.59 0.73 0.81 0.39 0.36 0.00 -0.24 -0.67 0.00 -1.02 0.00 4.55 4.55 1.29 0.00 0.37 -0.04 0.02 -0.05 0.55 -0.31 0.87 0.00 -0.23 0.66 0.50 -0.12 0.00 0.39 -0.09 -0.53 0.21 0.43 0.00 1.26 -1.05 0.00 -0.13 0.00 4.55 4.55 0.85 0.00 0.11 0.82 0.60 -0.46 0.53 0.45 -0.20 0.00 0.14 -0.35 -0.33 1.10 0.00 0.04 0.34 -0.27 0.31 0.28 0.00 -0.17 -0.59 0.00 0.08 0.00 4.55 4.55 0.33 0.00 0.22 0.10 0.10 -0.16 0.27 -0.07 -0.03 0.00 0.06 -0.13 -0.09 0.12 0.00 0.19 0.00 -0.01 0.51 0.15 0.00 0.00 -0.02 0.00 -0.16 0.00 3.49 3.49 -0.07 0.00 -0.59 -0.28 -0.19 0.40 -0.10 -0.08 0.31 0.00 0.12 0.51 0.09 0.08 0.00 -0.22 -0.19 0.46 0.27 0.34 0.00 0.38 -0.15 0.00 0.27 0.00 4.55 4.55 0.76 0.00 0.40 0.62 0.60 -0.23 0.69 0.08 0.07 0.00 -0.05 -0.21 -0.21 0.39 0.00 0.11 0.11 -0.36 0.62 0.32 0.00 0.13 -0.59 0.00 -0.08 0.00 4.55 4.55 0.48 0.00 -0.64 1.07 1.40 -1.00 0.84 0.30 -0.37 0.00 0.92 -0.57 -0.17 0.68 0.00 0.43 0.73 0.33 0.49 0.41 0.00 -0.16 -1.18 0.00 -0.96 0.00 4.55 4.55 0.27 0.00 0.12 0.05 0.05 -0.03 0.22 0.21 0.92 0.00 0.13 0.58 0.47 0.01 0.00 0.26 0.04 -0.02 -0.04 0.63 0.00 1.28 -0.92 0.00 -0.17 0.00 4.55 4.55 0.84 0.00 0.41 0.85 0.73 -0.84 1.99 -0.09 -0.44 0.00 -0.05 -0.76 -0.50 0.65 0.00 0.52 0.30 -0.27 1.16 0.57 0.00 0.17 -1.15 0.00 -0.81 0.00 4.55 4.55 1.04 0.00 0.09 0.88 0.78 -1.00 1.73 -0.04 -0.37 0.00 0.06 -0.56 -0.30 0.60 0.00 0.54 0.72 -0.24 0.69 0.66 0.00 0.20 -1.41 0.00 -0.90 0.00 4.55 4.55 0.22 0.00 -0.42 1.10 1.14 -0.58 0.34 1.15 -0.01 0.00 0.23 -0.17 -0.22 0.63 0.00 0.23 0.76 0.22 -0.01 0.15 0.00 0.11 -1.12 0.00 -0.21 0.00 4.55 4.55 1.40 0.00 0.14 0.65 0.50 -0.62 0.58 0.00 0.39 0.00 0.14 -0.03 0.11 0.28 0.00 0.46 0.32 -0.15 0.40 0.47 0.00 0.44 -1.03 0.00 -0.47 0.00 4.55 4.55 0.15 0.00 -0.45 -0.28 -0.13 0.99 0.18 -0.35 0.98 0.00 -0.42 1.28 1.00 -0.26 0.00 -0.22 -0.18 -0.60 -0.08 0.14 0.00 1.05 -0.09 0.00 0.15 0.00 4.55 4.55 0.29 0.00 -0.40 0.38 0.69 0.23 0.53 -0.06 0.60 0.00 -0.14 0.53 0.41 0.12 0.00 -0.07 0.13 -0.41 0.15 0.26 0.00 0.62 -0.79 0.00 -0.18 0.00 4.55 4.55 -0.31 0.00 0.35 -0.33 -0.33 0.41 -0.50 0.38 0.37 0.00 0.21 0.20 0.37 -0.11 0.00 -0.16 -0.10 0.69 -0.16 -0.13 0.00 0.34 1.19 0.00 0.27 0.00 4.55 4.55 0.28 0.00 -0.20 0.31 0.29 -0.30 0.63 -0.10 -0.09 0.00 0.36 -0.12 0.09 0.26 0.00 0.13 0.20 0.04 0.29 0.24 0.00 0.15 -0.38 0.00 -0.43 0.00 3.49 3.49 0.53 0.00 -0.45 -0.55 -0.29 1.13 -0.23 -0.27 0.93 0.00 -0.43 1.54 1.13 -0.39 0.00 -0.15 -0.25 -0.64 -0.21 0.06 0.00 0.97 0.23 0.00 0.45 0.00 4.55 4.55 -0.22 0.00 -0.80 -0.42 0.18 1.32 -0.41 0.02 0.73 0.00 -0.40 1.44 0.89 -0.29 0.00 -0.50 -0.27 -0.54 -0.31 -0.15 0.00 0.47 0.50 0.00 0.74 0.00 4.55 4.55 0.97 0.00 0.01 0.36 0.44 -0.53 0.53 -0.11 0.42 0.00 0.51 0.11 0.29 0.24 0.00 0.42 0.20 -0.04 0.34 0.82 0.00 0.68 -1.02 0.00 -0.55 0.00 4.55 4.55 0.29 0.00 0.10 -0.23 -0.13 0.56 0.17 -0.39 1.00 0.00 -0.13 0.92 0.73 -0.17 0.00 0.12 -0.24 -0.30 0.69 0.25 0.00 1.10 0.03 0.00 -0.13 0.00 4.55 4.55 0.32 0.00 0.19 0.51 0.76 0.05 0.13 0.77 -0.09 0.00 -0.01 -0.13 -0.24 0.45 0.00 -0.06 0.24 -0.16 0.01 0.45 0.00 -0.15 -0.41 0.00 0.34 0.00 4.55 4.55 0.45 0.00 -0.03 0.12 0.12 -0.95 0.21 0.48 -0.38 0.00 0.51 -0.55 -0.14 0.05 0.00 1.92 0.55 1.08 0.52 0.31 0.00 -0.03 -0.32 0.00 -1.24 0.00 4.55 4.55 0.43 0.00 -0.85 -0.19 0.07 0.32 -0.13 -0.10 0.02 0.00 0.24 0.65 0.54 -0.02 0.00 -0.17 0.08 0.50 0.22 -0.01 0.00 -0.02 -0.24 0.00 0.11 0.00 4.55 4.55 0.72 0.00 0.23 -0.20 -0.01 0.28 0.27 -0.17 0.44 0.00 -0.14 0.46 0.24 -0.01 0.00 0.15 -0.37 -0.45 0.25 1.15 0.00 0.33 -0.22 0.00 0.28 0.00 4.55 4.55 0.06 0.00 -1.17 0.06 0.23 0.32 -0.28 0.28 0.41 0.00 0.26 1.11 1.01 0.02 0.00 -0.02 1.05 0.07 -0.37 -0.12 0.00 0.48 0.06 0.00 -0.27 0.00 4.55 4.55 0.36 0.00 -0.39 1.05 1.26 -0.95 0.81 0.42 -0.38 0.00 0.58 -0.65 -0.25 0.61 0.00 0.37 0.66 0.56 0.68 0.29 0.00 -0.25 -0.52 0.00 -0.88 0.00 4.55 4.55 -0.61 0.00 -0.43 -1.17 -0.66 1.77 -0.82 -0.12 0.77 0.00 -0.27 1.56 0.84 -0.53 0.00 -0.73 -0.84 -0.39 -0.35 -0.31 0.00 0.29 1.54 0.00 1.41 0.00 4.55 4.55 -0.35 0.00 -0.07 -1.14 -0.66 1.49 -0.57 -0.02 0.61 0.00 -0.66 1.28 0.50 -0.59 0.00 0.02 -0.80 -0.45 -0.16 -0.21 0.00 0.29 1.03 0.00 1.15 0.00 4.55 4.55 0.62 0.00 -0.18 1.17 1.00 -1.03 0.80 0.28 -0.13 0.00 0.38 -0.53 -0.36 0.57 0.00 0.73 0.47 0.06 0.63 1.01 0.00 -0.04 -1.31 0.00 -0.81 0.00 4.55 4.55 0.19 0.00 0.05 0.13 0.18 -0.40 0.23 0.05 -0.02 0.00 0.81 -0.26 0.07 0.30 0.00 0.35 0.05 0.65 0.82 0.84 0.00 -0.07 0.46 0.00 -0.50 0.00 4.55 4.55 -0.54 0.00 -0.51 -0.97 -0.52 1.44 -0.75 -0.08 0.64 0.00 0.06 1.32 0.79 -0.38 0.00 -0.62 -0.65 -0.19 -0.27 -0.23 0.00 0.23 1.37 0.00 1.11 0.00 4.55 4.55 0.44 0.00 -0.28 0.58 0.54 -0.86 0.74 -0.05 -0.18 0.00 1.21 -0.49 0.03 0.57 0.00 0.35 0.34 0.44 0.55 1.05 0.00 0.03 -0.63 0.00 -0.86 0.00 4.55 4.55 0.21 0.00 0.33 0.78 0.52 -0.08 0.56 0.72 -0.27 0.00 -0.18 -0.35 -0.45 0.54 0.00 -0.15 0.24 -0.26 0.09 0.08 0.00 -0.14 -0.40 0.00 0.35 0.00 4.55 4.55 -0.29 0.00 -0.85 -0.98 -0.58 1.94 -0.76 -0.27 1.15 0.00 -0.58 2.13 1.49 -0.63 0.00 -0.56 -0.51 -0.67 -0.52 -0.04 0.00 0.96 1.02 0.00 0.90 0.00 4.55 4.55 0.59 0.00 0.25 0.32 0.32 -0.75 0.57 -0.01 -0.16 0.00 0.71 -0.50 -0.20 0.36 0.00 1.07 0.19 0.43 1.19 0.83 0.00 -0.01 -0.37 0.00 -0.90 0.00 4.55 4.55 0.37 0.00 -0.03 0.63 0.68 -0.49 0.39 0.81 -0.07 0.00 0.34 -0.31 -0.24 0.80 0.00 0.36 0.38 0.18 0.24 1.27 0.00 -0.07 -0.77 0.00 -0.20 0.00 4.55 4.55 0.54 0.00 -0.09 -0.05 0.30 0.16 0.21 0.09 0.30 0.00 -0.18 0.44 0.18 -0.06 0.00 0.53 -0.04 -0.25 0.19 0.19 0.00 0.35 -0.46 0.00 0.03 0.00 4.55 4.55 0.99 0.00 -0.34 1.72 1.21 -1.36 1.15 0.35 -0.29 0.00 0.29 -0.68 -0.49 0.74 0.00 0.54 0.74 -0.12 0.51 0.46 0.00 -0.07 -1.68 0.00 -0.83 0.00 4.55 4.55 0.76 0.00 -0.73 0.48 0.74 -0.18 0.26 0.26 0.19 0.00 0.13 0.54 0.52 0.23 0.00 0.23 0.90 -0.14 -0.01 0.14 0.00 0.32 -0.67 0.00 -0.41 0.00 4.55 4.55 0.28 0.00 -0.11 -0.18 -0.07 0.39 0.18 -0.31 0.80 0.00 0.05 0.92 0.91 0.02 0.00 0.08 -0.10 -0.12 0.51 0.23 0.00 0.97 -0.18 0.00 -0.19 0.00 4.55 4.55 -0.02 0.00 -0.72 0.30 0.37 -0.29 -0.23 0.74 -0.07 0.00 1.13 0.15 0.56 0.58 0.00 0.08 0.60 0.84 -0.05 0.11 0.00 -0.07 -0.15 0.00 -0.29 0.00 4.55 4.55 1.10 0.00 0.11 0.74 0.65 -0.97 1.56 -0.15 -0.36 0.00 0.37 -0.62 -0.24 0.55 0.00 0.68 0.41 -0.09 0.79 0.59 0.00 0.20 -1.25 0.00 -0.93 0.00 4.55 4.55 0.57 0.00 0.46 0.61 0.64 -0.63 0.91 0.04 -0.26 0.00 0.43 -0.65 -0.49 1.03 0.00 0.46 0.14 0.15 1.82 0.45 0.00 -0.26 0.05 0.00 -0.56 0.00 4.55 4.55 1.47 0.00 -0.03 0.53 0.73 -0.67 0.69 0.11 -0.03 0.00 0.10 -0.09 0.02 0.26 0.00 1.00 0.46 -0.17 0.49 0.49 0.00 0.25 -1.25 0.00 -0.69 0.00 4.55 4.55 0.31 0.00 -0.94 1.44 1.13 -1.38 0.46 0.67 -0.40 0.00 1.06 -0.50 -0.17 0.79 0.00 0.29 1.49 0.58 0.15 0.15 0.00 -0.33 -0.96 0.00 -0.94 0.00 4.55 4.55 0.42 0.00 0.02 -0.36 -0.30 0.56 0.16 -0.44 1.58 0.00 -0.34 1.44 1.11 -0.46 0.00 0.09 -0.24 -0.53 -0.19 0.26 0.00 2.09 -0.91 0.00 -0.06 0.00 4.55 4.55 -0.10 0.00 -0.84 0.43 0.43 -0.90 -0.24 0.49 -0.38 0.00 2.10 -0.52 0.26 0.59 0.00 0.24 0.70 1.50 0.25 0.20 0.00 -0.38 0.50 0.00 -0.87 0.00 4.55 4.55 1.13 0.00 -0.27 0.15 0.12 -0.38 0.49 -0.12 -0.28 0.00 0.50 -0.14 -0.09 0.29 0.00 0.27 0.19 0.34 0.62 0.30 0.00 -0.10 -0.39 0.00 -0.24 0.00 4.55 4.55 -0.07 0.00 -0.12 0.70 0.68 -0.24 -0.09 2.26 -0.50 0.00 0.14 -0.38 -0.50 0.82 0.00 0.35 0.95 0.72 -0.22 -0.10 0.00 -0.43 -0.30 0.00 0.37 0.00 4.55 4.55 1.19 0.00 0.25 0.87 0.75 -0.97 2.01 -0.26 -0.40 0.00 0.09 -0.69 -0.34 0.61 0.00 0.53 0.36 -0.34 0.89 0.64 0.00 0.28 -1.45 0.00 -0.91 0.00 4.55 4.55 0.18 0.00 -0.63 0.48 0.63 -0.63 0.15 0.07 0.28 0.00 1.35 0.02 0.40 0.37 0.00 0.17 0.45 0.58 0.19 0.33 0.00 0.47 -0.62 0.00 -0.74 0.00 4.55 4.55 -0.03 0.00 -0.58 0.19 0.25 -0.57 -0.13 0.19 -0.12 0.00 1.57 -0.25 0.31 0.38 0.00 0.19 0.33 1.07 0.27 0.60 0.00 -0.18 0.45 0.00 -0.63 0.00 4.55 4.55 0.25 0.00 0.22 -0.26 -0.26 0.34 0.14 -0.44 1.77 0.00 -0.09 1.18 0.95 -0.40 0.00 0.08 -0.28 -0.34 -0.12 0.33 0.00 2.14 -1.12 0.00 -0.18 0.00 4.55 4.55 0.40 0.00 -0.53 -0.28 -0.13 0.97 0.00 -0.34 1.08 0.00 -0.35 1.41 1.16 -0.29 0.00 -0.14 -0.08 -0.59 -0.14 0.17 0.00 1.14 -0.15 0.00 0.07 0.00 4.55 4.55 0.46 0.00 -0.22 1.15 0.86 -0.85 0.83 0.55 -0.09 0.00 0.30 -0.42 -0.32 0.95 0.00 0.26 0.52 0.00 0.35 0.74 0.00 0.07 -1.16 0.00 -0.44 0.00 4.55 4.55 2.01 0.00 0.67 0.37 0.37 -0.54 0.83 -0.13 -0.01 0.00 -0.04 -0.17 -0.08 0.31 0.00 0.63 0.16 -0.46 0.79 0.55 0.00 0.23 -0.83 0.00 -0.27 0.00 4.55 4.55 -0.19 0.00 -0.72 -0.74 -0.34 1.57 -0.52 -0.24 1.20 0.00 -0.51 1.92 1.34 -0.55 0.00 -0.45 -0.39 -0.62 -0.45 -0.12 0.00 1.16 0.51 0.00 0.68 0.00 4.55 4.55 0.87 0.00 0.28 0.69 0.60 -0.75 1.33 -0.06 -0.18 0.00 0.20 -0.53 -0.31 0.85 0.00 0.46 0.19 -0.20 0.92 1.12 0.00 0.12 -0.98 0.00 -0.62 0.00 4.55 4.55 0.94 0.00 -0.52 1.10 0.99 -0.65 0.64 0.29 0.01 0.00 0.22 -0.04 0.02 0.71 0.00 0.23 0.58 -0.23 0.29 0.35 0.00 0.10 -1.09 0.00 -0.44 0.00 4.55 4.55 1.43 0.00 0.41 0.39 0.35 -0.36 0.95 -0.30 0.58 0.00 -0.14 0.09 0.16 0.18 0.00 0.42 0.10 -0.50 0.52 0.57 0.00 0.76 -1.28 0.00 -0.44 0.00 4.55 4.55 0.18 0.00 -0.31 -0.38 -0.27 0.72 -0.04 -0.32 1.48 0.00 -0.30 1.58 1.23 -0.45 0.00 -0.02 -0.04 -0.45 -0.33 0.13 0.00 1.89 -0.61 0.00 -0.03 0.00 4.55 4.55 1.20 0.00 -0.06 0.49 0.49 -0.57 0.69 0.20 -0.10 0.00 0.44 -0.13 0.09 0.43 0.00 0.47 0.44 0.02 0.41 0.42 0.00 0.18 -0.76 0.00 -0.47 0.00 4.55 4.55 0.06 0.00 -0.19 0.60 0.60 -0.49 0.00 1.41 -0.41 0.00 0.70 -0.41 -0.29 0.73 0.00 0.38 0.86 0.80 0.32 0.05 0.00 -0.39 -0.04 0.00 -0.13 0.00 4.55 4.55 0.00 0.00 -0.85 -0.44 -0.24 0.85 -0.39 -0.30 1.06 0.00 0.28 1.58 1.55 -0.34 0.00 -0.20 -0.01 -0.06 -0.33 0.07 0.00 1.20 0.00 0.00 -0.06 0.00 4.55 4.55 0.61 0.00 -0.51 2.03 1.39 -1.44 1.27 0.40 -0.31 0.00 0.36 -0.78 -0.58 0.88 0.00 0.26 0.77 -0.11 0.48 0.59 0.00 -0.15 -1.73 0.00 -0.84 0.00 4.55 4.55 0.37 0.00 -0.52 1.64 1.20 -1.11 0.79 0.99 -0.42 0.00 0.42 -0.70 -0.58 1.31 0.00 0.19 0.86 0.16 0.30 0.26 0.00 -0.35 -1.16 0.00 -0.42 0.00 4.55 4.55 0.05 0.00 -0.62 -0.27 -0.09 0.84 -0.32 0.22 0.80 0.00 -0.10 1.30 1.13 -0.16 0.00 -0.08 0.07 -0.14 -0.33 0.38 0.00 0.85 -0.05 0.00 0.18 0.00 4.55 4.55 0.46 0.00 -0.55 0.77 1.09 -0.89 0.45 0.35 -0.15 0.00 0.83 -0.34 -0.05 0.44 0.00 0.85 0.66 0.43 0.39 0.38 0.00 0.05 -1.15 0.00 -0.97 0.00 4.55 4.55 0.98 0.00 0.02 0.70 0.61 -0.83 1.31 -0.08 -0.17 0.00 0.44 -0.44 -0.12 0.74 0.00 0.41 0.38 -0.09 0.65 0.54 0.00 0.29 -1.10 0.00 -0.73 0.00 4.55 4.55 1.05 0.00 -0.12 0.47 0.69 -0.46 0.59 -0.06 0.23 0.00 0.27 0.16 0.38 0.28 0.00 0.38 0.24 -0.14 0.34 1.10 0.00 0.32 -1.17 0.00 -0.51 0.00 4.55 4.55 -0.13 0.00 -0.58 -0.55 -0.29 1.37 -0.39 -0.21 0.84 0.00 -0.39 1.53 1.04 -0.36 0.00 -0.36 -0.36 -0.50 0.03 -0.09 0.00 0.68 0.84 0.00 0.59 0.00 4.55 4.55 1.03 0.00 0.08 0.24 0.30 -0.47 0.50 -0.21 0.07 0.00 0.65 0.01 0.37 0.30 0.00 0.45 0.19 0.20 0.93 0.43 0.00 0.18 -0.36 0.00 -0.59 0.00 4.55 4.55 1.00 0.00 -0.03 0.48 0.46 -0.83 0.57 0.15 -0.14 0.00 0.66 -0.37 -0.09 0.68 0.00 0.84 0.38 0.20 0.55 0.90 0.00 0.05 -0.86 0.00 -0.70 0.00 4.55 4.55 -0.17 0.00 -1.34 -0.84 -0.50 2.01 -0.84 -0.33 1.34 0.00 -0.50 2.51 2.01 -0.67 0.00 -0.50 -0.17 -0.67 -0.67 -0.17 0.00 1.34 0.84 0.00 0.50 0.00 4.55 4.55 0.76 0.00 0.46 0.32 0.32 -0.67 0.63 -0.05 -0.21 0.00 0.63 -0.56 -0.18 0.42 0.00 0.63 0.15 0.56 1.54 0.40 0.00 -0.14 0.41 0.00 -0.72 0.00 4.55 4.55 0.45 0.00 -0.88 1.88 1.68 -1.37 0.80 0.75 -0.38 0.00 0.55 -0.61 -0.44 1.02 0.00 0.22 1.27 0.15 0.25 0.24 0.00 -0.35 -1.53 0.00 -0.81 0.00 4.55 4.55 0.00 0.00 -0.88 -0.61 -0.34 1.51 -0.47 -0.33 1.04 0.00 -0.34 1.88 1.51 -0.44 0.00 -0.27 -0.17 -0.50 -0.04 -0.04 0.00 1.04 0.77 0.00 0.27 0.00 4.55 4.55 0.08 0.00 0.09 0.64 0.62 -0.30 0.15 1.75 -0.44 0.00 0.17 -0.44 -0.50 0.76 0.00 0.41 0.74 0.60 0.29 0.02 0.00 -0.37 -0.18 0.00 0.16 0.00 4.55 4.55 1.58 0.00 1.01 0.25 0.17 -0.67 1.11 -0.21 -0.02 0.00 -0.25 -0.62 -0.38 0.20 0.00 0.60 -0.04 -0.44 0.97 0.57 0.00 0.29 -1.41 0.00 -0.07 0.00 4.55 4.55 0.24 0.00 -0.34 0.94 0.74 -0.71 0.28 0.85 -0.07 0.00 0.66 -0.31 -0.17 0.63 0.00 0.28 0.60 0.41 0.13 0.62 0.00 -0.01 -0.79 0.00 -0.35 0.00 4.55 4.55 -0.04 0.00 -0.78 0.55 0.55 -0.78 -0.21 0.79 -0.38 0.00 1.89 -0.46 0.11 0.71 0.00 0.21 0.76 1.20 0.16 0.20 0.00 -0.38 0.08 0.00 -0.60 0.00 4.55 4.55 0.36 0.00 -0.63 -0.26 -0.08 0.93 -0.31 0.24 0.78 0.00 -0.27 1.37 1.07 -0.18 0.00 -0.04 0.14 -0.33 -0.32 0.03 0.00 0.90 0.06 0.00 0.26 0.00 4.55 4.55 -0.13 0.00 -0.48 0.38 0.38 -0.70 -0.21 0.90 -0.41 0.00 1.40 -0.52 0.06 0.55 0.00 0.35 0.68 1.45 0.31 0.08 0.00 -0.41 0.70 0.00 -0.60 0.00 4.55 4.55 0.00 0.00 -0.09 0.04 0.04 -0.09 -0.01 0.01 -0.03 0.00 0.21 -0.04 0.03 0.06 0.00 0.01 0.06 0.11 0.03 0.03 0.00 -0.03 0.01 0.00 -0.09 0.00 2.83 2.83 0.09 0.00 0.03 0.09 0.07 -0.09 0.21 -0.03 -0.04 0.00 -0.01 -0.07 -0.04 0.06 0.00 0.04 0.03 -0.04 0.09 0.06 0.00 0.03 -0.14 0.00 -0.09 0.00 2.83 2.83 0.33 0.00 0.45 -0.21 -0.21 0.32 0.29 -0.47 1.61 0.00 -0.21 0.98 0.73 -0.32 0.00 0.16 -0.34 -0.38 0.31 0.36 0.00 1.90 -0.91 0.00 -0.19 0.00 4.55 4.55 0.50 0.00 -0.40 1.13 0.80 -0.72 0.54 0.38 -0.07 0.00 0.12 -0.20 -0.28 0.42 0.00 0.47 0.43 -0.09 0.28 0.25 0.00 -0.06 -1.01 0.00 -0.37 0.00 4.55 4.55 0.55 0.00 -0.10 0.42 0.35 -0.73 0.32 0.32 0.19 0.00 0.19 -0.11 -0.04 0.11 0.00 1.39 0.71 0.29 0.33 0.33 0.00 0.36 -1.19 0.00 -0.94 0.00 4.55 4.55 0.50 0.00 -0.25 0.40 0.61 -0.36 0.42 -0.05 0.72 0.00 0.46 0.39 0.45 0.13 0.00 0.22 0.25 -0.02 0.13 0.36 0.00 1.06 -1.17 0.00 -0.53 0.00 4.55 4.55 0.16 0.00 -0.11 0.88 0.64 -0.34 0.31 0.88 -0.34 0.00 0.27 -0.44 -0.47 1.57 0.00 -0.20 0.43 -0.04 0.17 0.13 0.00 -0.41 -0.25 0.00 0.30 0.00 4.55 4.55 -0.40 0.00 -0.34 -1.18 -0.69 1.78 -0.70 -0.11 0.83 0.00 -0.69 1.65 0.86 -0.65 0.00 -0.27 -0.78 -0.56 -0.32 -0.26 0.00 0.50 1.18 0.00 1.21 0.00 4.55 4.55 0.11 0.00 -0.78 0.67 0.83 -1.02 0.09 0.60 -0.41 0.00 1.29 -0.48 0.09 0.52 0.00 0.51 1.05 1.17 0.23 0.13 0.00 -0.33 -0.04 0.00 -1.00 0.00 4.55 4.55 -0.32 0.00 -0.42 -0.96 -0.65 1.99 -0.80 -0.17 1.10 0.00 -0.68 1.95 1.30 -0.60 0.00 -0.69 -0.56 -0.75 -0.59 -0.25 0.00 0.97 1.06 0.00 1.13 0.00 4.55 4.55 -0.21 0.00 -0.66 -0.84 -0.54 1.76 -0.70 -0.35 1.55 0.00 -0.54 2.09 1.51 -0.65 0.00 -0.50 -0.46 -0.65 -0.50 -0.09 0.00 1.36 0.53 0.00 0.68 0.00 4.55 4.55 0.57 0.00 0.31 0.54 0.50 -0.76 1.07 -0.20 -0.29 0.00 0.79 -0.67 -0.28 0.59 0.00 0.49 0.18 0.31 1.56 0.50 0.00 -0.09 -0.13 0.00 -0.84 0.00 4.55 4.55 0.24 0.00 -0.40 0.85 1.05 -0.48 0.36 1.03 -0.03 0.00 0.30 -0.16 -0.18 1.01 0.00 0.17 0.68 0.19 0.09 0.19 0.00 0.09 -0.93 0.00 -0.16 0.00 4.55 4.55 0.91 0.00 0.71 -0.33 -0.32 0.16 0.31 -0.28 0.79 0.00 -0.46 0.35 0.32 -0.30 0.00 0.24 -0.31 -0.53 0.32 0.34 0.00 1.05 -1.14 0.00 0.39 0.00 4.55 4.55 0.36 0.00 -0.54 -0.45 -0.27 1.21 -0.41 -0.35 1.43 0.00 -0.36 1.70 1.36 -0.44 0.00 -0.21 -0.17 -0.59 -0.29 0.12 0.00 1.30 -0.03 0.00 0.23 0.00 4.55 4.55 0.47 0.00 -0.26 -0.37 -0.25 0.88 -0.15 -0.38 1.45 0.00 -0.34 1.51 1.20 -0.41 0.00 -0.06 -0.18 -0.56 -0.21 0.21 0.00 1.55 -0.42 0.00 0.09 0.00 4.55 4.55 0.28 0.00 0.49 -0.02 -0.04 -0.07 0.27 0.21 0.69 0.00 0.04 0.21 0.17 0.02 0.00 0.28 -0.04 0.03 0.42 0.26 0.00 0.98 -0.76 0.00 0.03 0.00 4.55 4.55 0.40 0.00 0.33 -0.08 -0.08 0.14 0.31 -0.38 1.39 0.00 -0.08 0.77 0.63 -0.19 0.00 0.20 -0.30 -0.38 0.08 1.15 0.00 1.57 -1.12 0.00 -0.23 0.00 4.55 4.55 0.33 0.00 -0.86 -0.55 -0.31 1.41 -0.48 -0.32 1.20 0.00 -0.40 1.93 1.56 -0.47 0.00 -0.25 -0.11 -0.62 -0.39 0.03 0.00 1.20 0.30 0.00 0.29 0.00 4.55 4.55 1.41 0.00 0.00 0.89 0.74 -0.87 0.64 0.54 -0.19 0.00 0.34 -0.35 -0.19 0.58 0.00 0.56 0.61 0.01 0.38 0.42 0.00 -0.01 -1.07 0.00 -0.41 0.00 4.55 4.55 0.59 0.00 0.21 0.36 0.43 -0.45 0.47 0.27 0.17 0.00 0.31 -0.13 0.02 0.31 0.00 0.47 0.22 0.28 0.65 0.68 0.00 0.32 -0.37 0.00 -0.45 0.00 4.55 4.55 -0.10 0.00 -0.10 0.27 0.27 -0.17 -0.19 1.38 0.12 0.00 0.26 0.04 0.06 0.35 0.00 0.32 0.58 0.81 -0.19 -0.03 0.00 0.30 -0.02 0.00 0.03 0.00 4.55 4.55 0.19 0.00 -0.34 -0.46 -0.20 1.05 -0.35 0.28 0.70 0.00 -0.39 1.24 0.78 -0.22 0.00 -0.16 -0.15 -0.37 -0.28 -0.06 0.00 0.65 0.35 0.00 0.68 0.00 4.55 4.55 1.19 0.00 0.28 0.51 0.45 -0.97 1.26 0.02 -0.33 0.00 0.03 -0.55 -0.33 0.28 0.00 1.54 0.42 -0.01 0.78 0.59 0.00 0.25 -1.45 0.00 -1.08 0.00 4.55 4.55 0.97 0.00 -0.10 0.77 0.68 -0.94 1.22 0.02 -0.35 0.00 0.67 -0.58 -0.19 0.90 0.00 0.41 0.47 0.06 0.68 0.53 0.00 0.03 -0.95 0.00 -0.76 0.00 4.55 4.55 0.46 0.00 -0.89 2.13 1.78 -1.45 0.86 0.63 -0.33 0.00 0.67 -0.72 -0.50 0.93 0.00 0.17 0.97 0.11 0.33 0.33 0.00 -0.33 -1.67 0.00 -0.85 0.00 4.55 4.55 -0.28 0.00 -0.20 -1.30 -0.80 1.86 -0.70 -0.17 0.67 0.00 -0.72 1.52 0.57 -0.60 0.00 -0.70 -0.99 -0.52 -0.21 -0.33 0.00 0.19 1.45 0.00 1.66 0.00 4.55 4.55 0.79 0.00 0.39 0.59 0.52 -0.69 1.39 -0.24 -0.02 0.00 0.15 -0.46 -0.23 0.47 0.00 0.52 0.02 -0.26 0.86 1.64 0.00 0.29 -1.13 0.00 -0.70 0.00 4.55 4.55 0.84 0.00 0.07 0.03 0.22 -0.34 0.36 0.17 -0.03 0.00 -0.05 0.01 -0.06 -0.01 0.00 1.35 0.18 0.02 0.43 0.34 0.00 0.19 -0.78 0.00 -0.50 0.00 4.55 4.55 1.12 0.00 -0.39 1.32 1.48 -1.09 0.88 0.39 -0.24 0.00 0.32 -0.47 -0.30 0.62 0.00 0.64 0.75 -0.09 0.47 0.45 0.00 -0.08 -1.63 0.00 -0.80 0.00 4.55 4.55 0.59 0.00 -0.23 -0.13 -0.06 0.22 0.13 -0.28 0.98 0.00 0.21 0.96 0.90 -0.16 0.00 0.16 0.01 -0.21 -0.02 0.29 0.00 1.32 -0.60 0.00 -0.24 0.00 4.55 4.55 0.10 0.00 -0.78 0.58 0.62 -0.35 -0.04 1.19 -0.17 0.00 0.31 0.22 0.17 0.63 0.00 0.23 1.43 0.43 -0.25 -0.12 0.00 -0.10 -0.31 0.00 -0.22 0.00 4.55 4.55 1.60 0.00 0.24 0.38 0.40 -0.54 1.03 -0.27 0.07 0.00 0.06 0.05 0.31 0.26 0.00 0.55 0.23 -0.29 0.68 0.53 0.00 0.41 -1.10 0.00 -0.55 0.00 4.55 4.55 1.41 0.00 0.80 0.40 0.40 -0.64 1.00 -0.27 -0.10 0.00 0.20 -0.47 -0.30 0.43 0.00 0.74 0.03 -0.10 1.77 0.57 0.00 0.03 -0.24 0.00 -0.60 0.00 4.55 4.55 -0.29 0.00 -0.52 -0.86 -0.64 1.61 -0.82 -0.18 0.74 0.00 -0.25 1.68 1.44 -0.47 0.00 -0.72 -0.37 -0.13 -0.51 -0.26 0.00 0.61 0.72 0.00 0.86 0.00 4.55 4.55 0.35 0.00 -0.50 1.14 0.87 -0.84 0.47 0.50 0.16 0.00 0.41 -0.19 -0.11 0.89 0.00 0.16 0.94 0.09 0.17 0.40 0.00 0.08 -1.08 0.00 -0.54 0.00 4.55 4.55 0.09 0.00 -0.26 0.19 0.16 -0.68 -0.11 0.05 0.03 0.00 1.63 -0.49 0.15 0.36 0.00 0.12 0.27 0.85 0.41 0.33 0.00 -0.03 -0.31 0.00 -0.42 0.00 4.55 4.55 0.55 0.00 0.24 -0.49 -0.29 0.76 -0.02 -0.31 1.20 0.00 -0.43 1.11 0.67 -0.36 0.00 -0.07 -0.47 -0.60 -0.03 0.19 0.00 1.14 -0.28 0.00 0.48 0.00 4.55 4.55 -0.07 0.00 -0.67 -0.71 -0.49 1.61 -0.56 -0.30 1.36 0.00 -0.50 2.05 1.57 -0.58 0.00 -0.41 -0.28 -0.66 -0.54 -0.07 0.00 1.50 0.38 0.00 0.51 0.00 4.55 4.55 1.16 0.00 -0.16 0.64 0.79 -0.38 0.64 0.01 0.12 0.00 0.11 0.11 0.16 0.34 0.00 0.38 0.35 -0.28 0.63 0.40 0.00 0.24 -0.79 0.00 -0.44 0.00 4.55 4.55 0.36 0.00 -0.06 0.32 0.42 -0.24 0.73 -0.04 -0.03 0.00 0.24 -0.07 0.16 0.28 0.00 0.32 0.21 0.24 0.90 0.28 0.00 0.18 0.13 0.00 -0.60 0.00 4.55 4.55 0.12 0.00 0.21 -0.52 -0.36 0.75 0.09 -0.39 1.27 0.00 -0.36 1.21 0.79 -0.40 0.00 -0.03 -0.49 -0.46 0.20 0.16 0.00 1.50 -0.16 0.00 0.26 0.00 4.55 4.55 1.38 0.00 0.45 0.35 0.35 -0.74 0.71 -0.02 -0.15 0.00 0.36 -0.41 -0.08 0.35 0.00 0.72 0.25 0.28 1.10 0.46 0.00 0.02 -0.11 0.00 -0.65 0.00 4.55 4.55 0.19 0.00 0.10 0.27 0.22 -0.07 0.10 0.24 0.15 0.00 0.55 -0.11 0.00 0.78 0.00 -0.09 0.03 0.03 0.20 0.82 0.00 0.03 -0.12 0.00 0.08 0.00 4.55 4.55 0.85 0.00 0.09 0.49 0.33 -0.41 0.57 -0.10 0.63 0.00 -0.03 0.30 0.25 0.09 0.00 0.30 0.15 -0.31 0.17 0.36 0.00 0.96 -1.20 0.00 -0.35 0.00 0.92 0.92 -0.09 0.00 -0.63 -0.54 -0.36 1.36 -0.59 -0.32 1.43 0.00 -0.36 1.73 1.36 -0.50 0.00 -0.36 -0.23 -0.50 -0.41 0.00 0.00 1.24 0.21 0.00 0.32 0.00 0.92 0.92 1.31 0.00 0.23 0.36 0.36 -0.60 0.63 -0.11 0.07 0.00 0.31 -0.17 0.03 0.30 0.00 0.53 0.16 -0.16 0.47 1.05 0.00 0.22 -0.87 0.00 -0.45 0.00 0.92 0.92 0.65 0.00 0.26 0.40 0.40 -0.44 0.39 0.51 -0.20 0.00 0.35 -0.35 -0.24 0.48 0.00 0.46 0.32 0.27 0.81 0.26 0.00 -0.14 -0.14 0.00 -0.25 0.00 0.92 0.92 0.04 0.00 -0.82 0.51 0.58 -0.82 -0.05 0.18 -0.27 0.00 1.89 -0.41 0.22 0.56 0.00 0.14 0.58 0.98 0.27 0.27 0.00 -0.27 -0.03 0.00 -0.81 0.00 0.92 0.92 -0.37 0.00 1.14 -0.67 -0.64 1.67 -0.78 0.33 0.21 0.00 -0.71 0.54 0.09 -0.17 0.00 -1.01 -0.74 -0.71 -0.53 -0.37 0.00 -0.04 1.31 0.00 1.83 0.00 0.92 0.92 -0.16 0.00 -0.43 0.35 0.34 -0.55 -0.20 0.97 -0.38 0.00 0.98 -0.43 0.00 0.60 0.00 0.26 0.63 1.21 0.07 0.00 0.00 -0.38 0.58 0.00 -0.38 0.00 0.92 0.92 0.14 0.00 -0.27 0.54 0.64 -0.34 0.25 0.19 -0.09 0.00 0.14 -0.17 -0.12 0.25 0.00 0.05 0.28 0.00 0.09 0.09 0.00 -0.09 -0.52 0.00 -0.24 0.00 0.92 0.92 0.18 0.00 -0.22 -0.12 -0.06 0.32 -0.08 -0.08 0.26 0.00 -0.10 0.48 0.39 -0.10 0.00 -0.03 0.00 -0.17 -0.07 0.02 0.00 0.29 0.05 0.00 0.06 0.00 0.92 0.92 0.41 0.00 0.11 0.24 0.21 -0.27 0.58 -0.08 -0.10 0.00 -0.03 -0.18 -0.10 0.16 0.00 0.17 0.09 -0.14 0.25 0.19 0.00 0.09 -0.44 0.00 -0.24 0.00 0.92 0.92 -0.10 0.00 0.33 -0.16 -0.16 0.43 -0.20 0.10 0.03 0.00 -0.20 0.10 -0.03 -0.03 0.00 -0.26 -0.20 -0.20 -0.13 -0.10 0.00 -0.03 0.36 0.00 0.49 0.00 0.92 0.92 0.07 0.00 -0.20 0.20 0.20 -0.26 0.07 0.20 -0.10 0.00 0.13 -0.03 0.00 0.13 0.00 0.10 0.49 0.13 -0.03 -0.03 0.00 -0.07 -0.16 0.00 -0.20 0.00 0.92 0.92 0.20 0.00 0.07 0.20 0.16 -0.20 0.49 -0.07 -0.10 0.00 -0.03 -0.16 -0.10 0.13 0.00 0.10 0.07 -0.10 0.20 0.13 0.00 0.07 -0.33 0.00 -0.20 0.00 0.92 0.92
prophet.pl
#!/usr/bin/perl
use XML::Compile::SOAP11;
use XML::Compile::WSDL11;
use XML::Compile::Transport::SOAPHTTP;
use strict;
####
eval {
my $inputs = {
'sequence' => { 'usa' => 'swissprot:H101_*'},
'infile_direct_data' => &file2String('globins.gribskov')
};
my $serviceendpoint =
'http://www.ebi.ac.uk/soaplab/typed/services/nucleic_profiles.prophet';
print "Retriving and processing the WSDL and the XSDs imported\n";
my $wsdl = XML::LibXML->new->parse_file( $serviceendpoint . '?wsdl' );
my $proxy = XML::Compile::WSDL11->new($wsdl);
foreach my $schema ( 1, 2, 3 ) {
my $xsdXml =
XML::LibXML->new->parse_file( $serviceendpoint . '?xsd=' . $schema );
if($XML::Compile::SOAP::VERSION < 2.0)
{
$proxy->schemas->importDefinitions($xsdXml);
}
else
{
$proxy->importDefinitions($xsdXml);
}
}
print "Preparing caller object for runAndWaitFor operation\n";
my $runAndWaitFor = $proxy->compileClient('runAndWaitFor');
print "Calling the service and getting the response\n";
my ( $answer, $trace ) = $runAndWaitFor->( $inputs );
# &printTrace($trace);
my %answer = %{$answer};
my %answer_ = %{ $answer{'runAndWaitForResponse'} };
my $report = $answer_{'report'};
my $detailed_status = $answer_{'detailed_status'};
my $outfile = $answer_{'outfile'};
my $outfile_url = $answer_{'outfile_url'};
print "\nSoaplab report received:\n----------------------------\n\n$report\n";
if ( $detailed_status == 0 ) {
print "Passed\n";
exit 0;
}
print "Failed\n";
exit 1;
};
if ($@) {
print "Caught an exception\n" . $@;
exit 1;
}
# Print request/response trace
sub printTrace($) {
my $trace = shift;
$trace->printTimings;
$trace->printRequest;
$trace->printResponse;
}
# File to String
sub file2String($) {
my $fname = shift;
open FILE, $fname or die "Couldn't open file: $!";
my $fcontent = join( "", <FILE> );
close FILE;
return $fcontent;
}
»
- Login to post comments